PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013626879.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 292aa    MW: 34579.8 Da    PI: 8.1161
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013626879.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix80.13.1e-2542124186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     +W+ +e+++Li++r e+++++ ++k++k lWe vs+kmr + f rsp+qCk+kw+nl +r+k +++++ +    +++++p++d++e
  XP_013626879.1  42 QWSLEETKELIAIRGELDQTFMETKRNKLLWEVVSNKMRVKSFLRSPEQCKCKWKNLVTRFKGCETTDAES---ARQQFPFYDDME 124
                     7********************************************************************84...45689*****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.002339101IPR001005SANT/Myb domain
CDDcd122031.71E-2141106No hitNo description
PfamPF138371.5E-1942124No hitNo description
PROSITE profilePS500907.5384399IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MDGRQLHHLQ YLNKHNHHVH PQSQTPEIAS PATVAAGDRF PQWSLEETKE LIAIRGELDQ  60
TFMETKRNKL LWEVVSNKMR VKSFLRSPEQ CKCKWKNLVT RFKGCETTDA ESARQQFPFY  120
DDMEIIFTSR MQRMIWVESE GGGGGASGTT RKRSHSEQFS SDEEEENVNE ELVDISNDPK  180
ILNPKKNIVK KRKGGISNSN ASNSVREVLD EFMRHQMRME NGWRERWEAR EKERAEREEE  240
WRGKMEEIEK ERVKMERMWR DREDQRRSRE ETRAEKRDSL INALLAKLTR DG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A4e-1339120384DNA binding protein GT-1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1183192PKKNIVKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4535820.0AF453582.1 Arabidopsis thaliana GT-1 like transcription factor (GT1L) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626879.10.0PREDICTED: trihelix transcription factor GT-3b-like
SwissprotO804501e-124TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A078FNK20.0A0A078FNK2_BRANA; BnaC03g21210D protein
TrEMBLA0A0D3B5K50.0A0A0D3B5K5_BRAOL; Uncharacterized protein
STRINGBra000046.1-P1e-178(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22152870
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.11e-108Trihelix family protein